Transcript | Ll_transcript_527828 |
---|---|
CDS coordinates | 189-1442 (+) |
Peptide sequence | MELQLVQKGLDYARKRKKLILILCAVGFTGYSAYRVYHAPSIARKRKRLSRVLGAFVSVAESVSESAETIRVVSRDMKDFLQSDLDEIPNSLKQISKLARSRHFSDSLVSVTCAVTIGILGGYHQSMNRSDHDQTGAGSSFVDLVVDKLFRPAGSGFASVVVGSFARNMVLAFYSDGQCSEESNSSNSTCVTNVVSNSNNVNPTWVDVVCSDKCSGLIGNCVQLFVSTAVAVYLDKTMHINPYDDFFSGLTNPKHETQMRDVLVSVCNGGIDTLVKTSHQVLTSSPSCLAIGESPARNEELGVETSQSVESKSGYVSDVENDSGWVSKVSSTLAVPSNRRLVLDMTGRVTFETVRSFMEFIMQTFCASVKRCAHIVHEAVIELIGYAAAKSFVVLTICFSLCLHIMGGSGCWALVNA* |
ORF Type | complete |
Blastp | Protein PHLOEM PROTEIN 2-LIKE A10 from Arabidopsis with 47.61% of identity |
---|---|
Blastx | Protein PHLOEM PROTEIN 2-LIKE A10 from Arabidopsis with 46.86% of identity |
Eggnog | Protein PHLOEM PROTEIN 2-LIKE(ENOG4111YI2) |
Kegg | Link to kegg annotations (AT1G10150) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422277.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer