Transcript | Ll_transcript_293215 |
---|---|
CDS coordinates | 156-845 (+) |
Peptide sequence | MASHLFNLSLSSPPKLSFNYYTPIPLSHFFSIPYSKRCRFTNRNSLRRPHFAVSNSSLTHTSSPLLLDVTGMMCGACVSRVKNILSADDRVDSVVVNMLTETAAVKLKRHEDEVGGVAEGLARRLSECGFPTKRRASGLGVAENVKKWKELVKKKEELVVKSRNRVAFAWTLVALCCGSHASHIFHSLGIHIAHGTNSLLDYHRGVYIYCSIFSVTSCLCNWLEKKYLS* |
ORF Type | complete |
Blastp | Copper-transporting ATPase PAA2, chloroplastic from Arabidopsis with 64.46% of identity |
---|---|
Blastx | Copper-transporting ATPase PAA2, chloroplastic from Arabidopsis with 74.22% of identity |
Eggnog | p-type ATPase(COG2217) |
Kegg | Link to kegg annotations (AT5G21930) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437831.1) |
Pfam | Heavy-metal-associated domain (PF00403.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer