Protein coding transcript 6777

• Transcript: Ll_transcript_527829
• CDS coordinates: 298-1323 (+)
• Peptide sequence: MKDFLQSDLDEIPNSLKQISKLARSRHFSDSLVSVTCAVTIGILGGYHQSMNRSDHDQTGAGSSFVDLVVDKLFRPAGSGFASVVVGSFARNMVLAFYSDGQCSEESNSSNSTCVTNVVSNSNNVNPTWVDVVCSDKCSGLIGNCVQLFVSTAVAVYLDKTMHINPYDDFFSGLTNPKHETQMRDVLVSVCNGGIDTLVKTSHQVLTSSPSCLAIGESPARNEELGVETSQSVESKSGYVSDVENDSGWVSKVSSTLAVPSNRRLVLDMTGRVTFETVRSFMEFIMQTFCASVKRCAHIVHEAVIELIGYAAAKSFVVLTICFSLCLHIMGGSGCWALVNA*
• ORF Type: complete

Annotations of Ll_transcript_527829

• Blastp: Protein PHLOEM PROTEIN 2-LIKE A10 from Arabidopsis with 46.51% of identity
• Blastx: Protein PHLOEM PROTEIN 2-LIKE A10 from Arabidopsis with 47.78% of identity
• Eggnog: Protein PHLOEM PROTEIN 2-LIKE(ENOG4111YI2)
• Kegg: Link to kegg annotations (AT1G10150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422277.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;