Protein coding transcript 67818

• Transcript: Ll_transcript_292767
• CDS coordinates: 433-1356 (+)
• Peptide sequence: MSMEYLQGRALLNAIGNLQLSGPYAEALRKLGQNLEDVANQEPDAALGNGGLGRLASCFLDSLATLNYPAWGYGLRYKYGLFKQLITKDGQEEEAESWLEMGNPWEIQRNDVSYPVKFYGEVISGPNGTKQWIGGENISAVAYDVPIPGYKTRTTINLRLWSIKVSPAQFDLQAFNTGDHAKAYAAMNNAEKICYVLYPGDESLEGKILRLKQQYTLCSASLQDIFARFEKRSGNTVNWDTFPEKVVVQMNDTHPTLCIPELIRILIDGKGLSWEKAWDITKSLIPLSMALLLERLLTQTTQFCRKR*
• ORF Type: complete

Annotations of Ll_transcript_292767

• Blastp: Alpha-1,4 glucan phosphorylase L-2 isozyme, chloroplastic/amyloplastic from Solanum with 78.26% of identity
• Blastx: Alpha-1,4 glucan phosphorylase L-2 isozyme, chloroplastic/amyloplastic from Solanum with 80.51% of identity
• Eggnog: Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties (By similarity)(COG0058)
• Kegg: Link to kegg annotations (102603391)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445910.1)
• Pfam: Carbohydrate phosphorylase (PF00343.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;