Transcript | Ll_transcript_290907 |
---|---|
CDS coordinates | 2-361 (+) |
Peptide sequence | SICFLSLSTLHHQLQDRDVIGSKKFVSDMVGHGQETIICAGSDVCLKKKELLSSAMKRTSEWISSQEIASDINVQIGEATFLLHKVEHKLLLGRNLRHFQGLKLEEEKIVIIMVRKICQR |
ORF Type | internal |
Blastp | BTB/POZ domain-containing protein At5g67385 from Arabidopsis with 76.92% of identity |
---|---|
Blastx | BTB/POZ domain-containing protein At5g67385 from Arabidopsis with 76.92% of identity |
Eggnog | BTB POZ domain-containing protein(ENOG410XRIY) |
Kegg | Link to kegg annotations (AT5G67385) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421013.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer