Protein coding transcript 67984

• Transcript: Ll_transcript_291600
• CDS coordinates: 244-1404 (+)
• Peptide sequence: MAPMGDNVVVSNMELERLLSMKGGKGEASYANNSQAQAIHAKSMLHLLKETLDGVQLHAHDIPFVVVDLGCSCGSNTINVVDVIIKHIIKRYEALGIDPPEFSAFFSDLPSNDFNTLFQLLPPVASYGVSMEECLAANNHRSYFAAGVPGSFYRRLFPGNSINIFHSAFSLHWLSQVPEIVLDKTTNAYNKGRVFIHGASEITANAYKKQFQTDLAGFLSARSVEMKTGGSMFLVCLGRTSMDPTDQGGAGLLFGTHFQDAWDDLVQEGLISSEKRDNFNIPVYAPSLQDFKEVVESDGSFAINKLEVFKGGSPLVVNQPDDASEVGRALANSCRSVSGVLVDAHIGDKLSEELFLRVARRATGHGKELLEQLQFFHIIASLTFAE*
• ORF Type: complete

Annotations of Ll_transcript_291600

• Blastp: Indole-3-acetate O-methyltransferase 1 from Arabidopsis with 73.58% of identity
• Blastx: Indole-3-acetate O-methyltransferase 1 from Arabidopsis with 73.58% of identity
• Eggnog: indole acetic acid carboxyl methyltransferase activity(ENOG410Y96G)
• Kegg: Link to kegg annotations (AT5G55250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418327.1)
• Pfam: SAM dependent carboxyl methyltransferase (PF03492.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;