| Transcript | Ll_transcript_293188 |
|---|---|
| CDS coordinates | 2-346 (+) |
| Peptide sequence | LQMHRRRHKVPWKLLKRDTPMVKKRVFVCPEPTCLHHQPCHALGDLVGIKKHFRRKHSNYKQWVCERCSKGYAVQSDYKAHLKTCGTRGHSCDCGRVFSRFLFIYLLNIFFYGY* |
| ORF Type | 5prime_partial |
| Blastp | Protein SHOOT GRAVITROPISM 5 from Arabidopsis with 93.07% of identity |
|---|---|
| Blastx | Protein SHOOT GRAVITROPISM 5 from Arabidopsis with 93.07% of identity |
| Eggnog | Zinc finger protein(COG5048) |
| Kegg | Link to kegg annotations (AT2G01940) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019431363.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer