Protein coding transcript 68007

• Transcript: Ll_transcript_290563
• CDS coordinates: 2-433 (+)
• Peptide sequence: DWAPQLLILEHVAVGGFLTHCGWNSTLEAVSSGVPMITWPLSAEQFSNEKLVTDVLKVGVQVGSKEWVFWNAETEWKGTVGRKNVELAVKKLMGKSEEAEKMRTRVKEIARKARIAVEEGGTSYAEVDALIEELKAHRVALKA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_290563

• Blastp: Abscisate beta-glucosyltransferase from Vigna with 71.94% of identity
• Blastx: Abscisate beta-glucosyltransferase from Vigna with 71.94% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (BAB83692)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422174.1)
• Pfam: UDP-glucoronosyl and UDP-glucosyl transferase (PF00201.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;