Transcript | Ll_transcript_291126 |
---|---|
CDS coordinates | 2-1327 (+) |
Peptide sequence | QEAELAKERTHGYKLDRAHVFSVNMFDDFDRFMKVPNQWAPPETKPYAPGENLQHWLTDAKARDQFVIRAGSDTEVLWNDARHLKPDPVYKRTFWTESFVQWSPLGTYLATVHRQGAAVWGGASTFNRLMRYAHPQVKLIDFSPGEKYLVTYSSHEPSNPRDANRVVINIFDVRTGKVMRDFKGSADDFAIGGAGGVTGVSWPVFKWSNGGDDKYFARIGKNVLSVYETDTFSLVDKKSIKVENIIDFSWSPTDPIIALFVPEMGGGNQPARVSLVQIPSKEELRQKNLFSVSDCKMYWQSNGDYLAVHVDRFTKTKKSTYTGFELFYIKERDIPIEVLELENKNDKIISFAWEPKGHRFAVIHGDNPKPDVSFYSMRTAQHTGRVSKLTTSKGKQANALFWSPVGHFIVLAGLKGFNGQLEFYNVDDLETMATTEHFMATD |
ORF Type | internal |
Blastp | Eukaryotic translation initiation factor 3 subunit B from Arabidopsis with 76.92% of identity |
---|---|
Blastx | Eukaryotic translation initiation factor 3 subunit B from Arabidopsis with 76.92% of identity |
Eggnog | Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(COG5354) |
Kegg | Link to kegg annotations (AT5G27640) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435267.1) |
Pfam | Eukaryotic translation initiation factor eIF2A (PF08662.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer