Protein coding transcript 68087

• Transcript: Ll_transcript_291136
• CDS coordinates: 2-1327 (+)
• Peptide sequence: QEAELAKERTHGYKLDRAHVFSVNMFDDFDRFMKVPNQWAPPETKPYAPGENLQHWLTDAKARDQFVIRAGSDTEVLWNDARHLKPDPVYKRTFWTESFVQWSPLGTYLATVHRQGAAVWGGATTFNRLMRYAHPQVKLIDFSPGEKYLVTYSSHEPSNPRDANRVVINIFDVRTGKLMRDFKGSADDFAIGGAGGVTGVSWPIFKWSNGGDDKYFARMGKNVLSVYETETFSLIDKKSLKVENIVDFSWSPTDPIIALFVPEMGGGNQPARVSLVQIPSKEELRQKNLFSVSDCKMYWQSNGDYLAVNVDRFTKTKKSTYTGFELFYIKERDIPIEVLELENKNDKIIAFAWEPKGNRFAVIHGDNPKPDVSFYTMRTAQHTGRVSKLTTLKGKQANALFWSPVGRFIVLAGLKGFNGQLEFYNVDDLETMATTEHFMATD
• ORF Type: internal

Annotations of Ll_transcript_291136

• Blastp: Eukaryotic translation initiation factor 3 subunit B from Arabidopsis with 77.38% of identity
• Blastx: Eukaryotic translation initiation factor 3 subunit B from Arabidopsis with 77.38% of identity
• Eggnog: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(COG5354)
• Kegg: Link to kegg annotations (AT5G27640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417208.1)
• Pfam: Eukaryotic translation initiation factor eIF2A (PF08662.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;