Protein coding transcript 68132

• Transcript: Ll_transcript_291834
• CDS coordinates: 1158-1823 (+)
• Peptide sequence: MFINLILMCRVYQLLHVLEFSSSRKRMSVIIRNEENQLLLLCKGADSVMFERLSQNERQFEAETKDHIKRYAEAGLRTLVIAYRKLCEEEYKLWGEEFSKAKASVSANRDALVDAAVDKMERDLILLGATAVEDRLQSGVPECIDKLAQAGIKLWILTGDKMETAVNIGYACSLLRQDMKQIVISLDSPDILSLEKHGDKEALVKVHDLGIWLKYTFDSYM*
• ORF Type: complete

Annotations of Ll_transcript_291834

• Blastp: Probable phospholipid-transporting ATPase 8 from Arabidopsis with 71.94% of identity
• Blastx: Probable phospholipid-transporting ATPase 8 from Arabidopsis with 71.94% of identity
• Eggnog: Phospholipid-transporting atpase(ENOG410XPYK)
• Kegg: Link to kegg annotations (AT3G27870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442566.1)
• Pfam: Cation transport ATPase (P-type) (PF13246.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;