Protein coding transcript 68137

• Transcript: Ll_transcript_291838
• CDS coordinates: 221-805 (+)
• Peptide sequence: MYNCILFLQYPFLYLEGVEDTLFSWPRIIGWMLNGVISSLLIFFLTTNSSLNQAFRKDGQMVGYEILGVTMYTCVVWTVNCQLALSINYFTWIQHFFIWGSIAFWYIFLLVYGYISPTISTTAYRVFVEACAFSALYWLVTLLVLLCVLLPYFCYRAFQSRFLPMYHDVLQRKQVEEGFEFEISNELHRKVHGK*
• ORF Type: complete

Annotations of Ll_transcript_291838

• Blastp: Probable phospholipid-transporting ATPase 8 from Arabidopsis with 65.14% of identity
• Blastx: Probable phospholipid-transporting ATPase 8 from Arabidopsis with 65.14% of identity
• Eggnog: Phospholipid-transporting atpase(ENOG410XPYK)
• Kegg: Link to kegg annotations (AT3G27870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442562.1)
• Pfam: Phospholipid-translocating P-type ATPase C-terminal (PF16212.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;