Transcript | Ll_transcript_291839 |
---|---|
CDS coordinates | 1766-2260 (+) |
Peptide sequence | MFERLSQNERQFEAETKDHIKRYAEAGLRTLVIAYRKLCEEEYKLWGEEFSKAKASVSANRDALVDAAVDKMERDLILLGATAVEDRLQSGVPECIDKLAQAGIKLWILTGDKMETAVNIGYACSLLRQDMKQIVISLDSPDILSLEKHGDKEALVKILDTNIA* |
ORF Type | complete |
Blastp | Putative phospholipid-transporting ATPase 9 from Arabidopsis with 65.64% of identity |
---|---|
Blastx | Probable phospholipid-transporting ATPase 8 from Arabidopsis with 65.03% of identity |
Eggnog | Phospholipid-transporting atpase(ENOG410XPYK) |
Kegg | Link to kegg annotations (AT1G68710) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442562.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer