Protein coding transcript 68138

• Transcript: Ll_transcript_291839
• CDS coordinates: 1766-2260 (+)
• Peptide sequence: MFERLSQNERQFEAETKDHIKRYAEAGLRTLVIAYRKLCEEEYKLWGEEFSKAKASVSANRDALVDAAVDKMERDLILLGATAVEDRLQSGVPECIDKLAQAGIKLWILTGDKMETAVNIGYACSLLRQDMKQIVISLDSPDILSLEKHGDKEALVKILDTNIA*
• ORF Type: complete

Annotations of Ll_transcript_291839

• Blastp: Putative phospholipid-transporting ATPase 9 from Arabidopsis with 65.64% of identity
• Blastx: Probable phospholipid-transporting ATPase 8 from Arabidopsis with 65.03% of identity
• Eggnog: Phospholipid-transporting atpase(ENOG410XPYK)
• Kegg: Link to kegg annotations (AT1G68710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442562.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;