Protein coding transcript 68151

• Transcript: Ll_transcript_291306
• CDS coordinates: 486-944 (+)
• Peptide sequence: MFYGAVVWDPWLIVGQIVCLQCLYYITLGMFLSLLVGTRVSRMSLVYFFDYVTITTSTITGWCVIASFLFSSLAGAVYMLYLIERAKKCLDFSATLYIIHLFICIVFGGWPSSITWWIVQGTGIAVMALLGEYLCIKRELREIPITRYRSNV*
• ORF Type: complete

Annotations of Ll_transcript_291306

• Blastp: Protein SYS1 homolog from Dictyostelium with 44.67% of identity
• Blastx: Protein SYS1 homolog from Dictyostelium with 44.67% of identity
• Eggnog: SYS1 Golgi-localized integral membrane protein homolog (S. cerevisiae)(ENOG4111H59)
• Kegg: Link to kegg annotations (DDB_G0269368)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425094.1)
• Pfam: Integral membrane protein S linking to the trans Golgi network (PF09801.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;