Protein coding transcript 68162

• Transcript: Ll_transcript_291294
• CDS coordinates: 1208-2344 (+)
• Peptide sequence: MRELLLAGADPNAVDDEGESVLHRAISKKYTDCALMILENGGCRSMAILNSKNLTPLHLCVATWNVAVVKRWVEVATSDEIAKAIDIPSSVGTALCMAAASKKDHETEGRELVRILLAAGADPSAQDSQNGRTVLHTAAMTNDVDLVKVILAACVDVNICNVHNSIPLHLALARGAKECVGLLLAAGADCNLQDDDGDNAFHIAAQTAKMIRENLDWLIVMLRNPNAGIEVRNHSGKTPRDILEALPREWISEDLMEALMNRGVCLSPTIFEVGDWVKFRRTVVTPIHGWQGARKKSVGFVQSFLDRDNLIVSFCSGEVHVLANEVVKVIPLDRGQHVQLKKDVKEPRFDLIPFSYYMSMCEGLYFSLSDEKKLSGTG*
• ORF Type: complete

Annotations of Ll_transcript_291294

• Blastp: E3 ubiquitin-protein ligase KEG from Arabidopsis with 75.64% of identity
• Blastx: E3 ubiquitin-protein ligase KEG from Arabidopsis with 77.53% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT5G13530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437104.1)
• Pfam: Ankyrin repeats (many copies) (PF13637.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;