Protein coding transcript 68165

• Transcript: Ll_transcript_291307
• CDS coordinates: 2411-3127 (+)
• Peptide sequence: MERVEEFNVGDWVRIRPTLTSAKHGLGSVTPGSIGIVYCIRPDSSLLIELSYLPNPWLCEPEEVEHVAPFRIGDRVCVKRSVAEPRYAWGGETHHSVGRISEIENDGLLIIDIPNRPIPWQADPSDMEKVEDFKVGDWVRVKASVSSPKYGWEDITRNSIGIIHSLEEDGDVGVAFCFRSKPFSCSLTDVEKAPPFELGQEIHVMASVTQPRLGWSNESPATVGKIVRIDMDGALNVS*
• ORF Type: complete

Annotations of Ll_transcript_291307

• Blastp: E3 ubiquitin-protein ligase KEG from Arabidopsis with 85.29% of identity
• Blastx: E3 ubiquitin-protein ligase KEG from Arabidopsis with 80.79% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT5G13530)
• CantataDB: Link to cantataDB annotations (CNT0002034)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437104.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;