Protein coding transcript 68166

• Transcript: Ll_transcript_291310
• CDS coordinates: 3-821 (+)
• Peptide sequence: YGSVQSEMQRNEGRLTLEQVLRYGADIARGVVELHAAGVVCMNLKPSNLLLNANGHAVVSDYGLATILKKPSCWKARPECDNSKIHSCMECIMLSPHYTAPEAWEPVKKSLNLFWDDAIGISSELDAWSFGCTLVEMCTGSIPWAGLSAEEIYRAVVKAKKLPPQYASVVGGGIPRELWKMIGECLQFKPSKRPTFNAMLAIFLRHLQEIPHSPPASPDNDSVKVSVSNVTEPSQVPELEVPQENPNHLLHRLVSEGDASGVRLVGVTTHLA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_291310

• Blastp: E3 ubiquitin-protein ligase KEG from Arabidopsis with 72.62% of identity
• Blastx: E3 ubiquitin-protein ligase KEG from Arabidopsis with 72.62% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT5G13530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437104.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;