Transcript | Ll_transcript_291315 |
---|---|
CDS coordinates | 1043-1666 (+) |
Peptide sequence | MTWKFAKCRYGADIARGVVELHAAGVVCMNLKPSNLLLNANGHAVVSDYGLATILKKPSCWKARPECDNSKIHSCMECIMLSPHYTAPEAWEPVKKSLNLFWDDAIGISSELDAWSFGCTLVEMCTGSIPWAGLSAEEIYRAVVKAKKLPPQYASVVGGGIPRELWKMIGECLQFKPSKRPTFNAMLAIFLRHLQEIPHSPPASPDK* |
ORF Type | complete |
Blastp | E3 ubiquitin-protein ligase KEG from Arabidopsis with 77.39% of identity |
---|---|
Blastx | E3 ubiquitin-protein ligase KEG from Arabidopsis with 77.39% of identity |
Eggnog | Ankyrin Repeat(COG0666) |
Kegg | Link to kegg annotations (AT5G13530) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_013442573.1) |
Pfam | Protein tyrosine kinase (PF07714.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer