Transcript | Ll_transcript_291304 |
---|---|
CDS coordinates | 1548-1865 (+) |
Peptide sequence | MVGPEYARYCGIEALEPLGIYLPGDINYPGGALFDPLNLSKDPEAFEELKVKEIKNGRLAMAAWLGFSVQAALTGKGPVQNLVEHISDPFHNNLLSSLNFMKVVL* |
ORF Type | complete |
Blastp | Chlorophyll a-b binding protein 7, chloroplastic from Arabidopsis with 84.85% of identity |
---|---|
Blastx | Chlorophyll a-b binding protein 7, chloroplastic from Arabidopsis with 85.38% of identity |
Eggnog | Chlorophyll A-B binding protein(ENOG410YIPW) |
Kegg | Link to kegg annotations (AT1G76570) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449531.1) |
Pfam | Chlorophyll A-B binding protein (PF00504.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer