Transcript | Ll_transcript_291308 |
---|---|
CDS coordinates | 473-1237 (+) |
Peptide sequence | MEQTKKFALQNSAKFKALAEKARKESFWYGEDRPRWLGPISYDYPSYLTGELPGDYGFDIAGLAKDPVALQKYLNFEILHARWAMLASVGALVPEILDLLGAFHFVEPVWWRVGYSKLKGDTLDYLGIPGLHLAGSQGVIVIAICQVLLMVGPEYARYCGIEALEPLGIYLPGDINYPGGALFDPLNLSKDPEAFEELKVKEIKNGRLAMAAWLGFSVQAALTGKGPVQNLVEHISDPFHNNLLSSLNFMKVVL* |
ORF Type | complete |
Blastp | Chlorophyll a-b binding protein 7, chloroplastic from Arabidopsis with 78.23% of identity |
---|---|
Blastx | Chlorophyll a-b binding protein 7, chloroplastic from Arabidopsis with 78.14% of identity |
Eggnog | Chlorophyll A-B binding protein(ENOG410YIPW) |
Kegg | Link to kegg annotations (AT1G76570) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449531.1) |
Pfam | Chlorophyll A-B binding protein (PF00504.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer