Protein coding transcript 68196

• Transcript: Ll_transcript_291124
• CDS coordinates: 778-1341 (+)
• Peptide sequence: MKQGVLTPGRVRLLLHRGTPCFRGYGRRTGERRRKSVRGCIVSPDLSVLNLVIVKKGDNDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKNGKKVSKAPKIQRLVTPLTLQRKRARIADKKKRIAKAKSDAAEYQKLLASRLKEQRERRSESLAKKRSRLSSATKQPATA*
• ORF Type: complete

Annotations of Ll_transcript_291124

• Blastp: 40S ribosomal protein S6-2 from Arabidopsis with 91.98% of identity
• Blastx: 40S ribosomal protein S6 from Asparagus with 91.07% of identity
• Eggnog: 40s ribosomal protein s6(COG2125)
• Kegg: Link to kegg annotations (AT5G10360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419846.1)
• Pfam: Ribosomal protein S6e (PF01092.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;