Protein coding transcript 68198

• Transcript: Ll_transcript_291103
• CDS coordinates: 175-924 (+)
• Peptide sequence: MKFNIANPTTGCQKKLEIDDDLKLRAFWDKRISQEVLGDALGEEFKGYVFKITGGCDKQGFPMKQGVLTPGRVRLLLYRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGDNDLPGLTDIEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKNGKKVSKAPKIQRLVTPLTLQRKRARIADKKKRIAKAKSDAAEYQKLLASRLKEQRERRSESLAKKRSRLSSATKQPATA*
• ORF Type: complete

Annotations of Ll_transcript_291103

• Blastp: 40S ribosomal protein S6 from Asparagus with 91.16% of identity
• Blastx: 40S ribosomal protein S6 from Asparagus with 91.53% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419846.1)
• Pfam: Ribosomal protein S6e (PF01092.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;