Protein coding transcript 68209

• Transcript: Ll_transcript_291920
• CDS coordinates: 59-943 (+)
• Peptide sequence: MTSPHSPIPTTPLTSPFHFSPRSIFCSVTVYNITMEMMNATIDSALVLLVPSFREIKVAVAASVFVFFAYFFFTYRTDNIAEDRSLNDKDKMGLLKGDSQTSSGYLIKSELLAAKNLSGANLKGTSDPYAIITCGNEKRFSSMVPGSRNPMWGEEFNFSVDKLPVQINITIYDWDIIWKSAVLGSVIVPVESEGQTGVVWHTLDSSSGQVCLHIKTTKRSANSSRVNDYGGGNTRRRMPLEKQGPTVVHQKPGPLQTIFDLLPDEVVDHDYSCALERSFLYHDYSCALERSFLYH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_291920

• Blastp: BAG-associated GRAM protein 1 from Arabidopsis with 63.04% of identity
• Blastx: BAG-associated GRAM protein 1 from Arabidopsis with 72.31% of identity
• Eggnog: GRAM domain-containing protein(ENOG410ZP01)
• Kegg: Link to kegg annotations (AT3G59660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423975.1)
• Pfam: C2 domain (PF00168.29)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;