Transcript | Ll_transcript_291924 |
---|---|
CDS coordinates | 59-736 (+) |
Peptide sequence | MTSPHSPIPTTPLTSPFHFSPRSIFCSVTVYNITMEMMNATIDSALVLLVPSFREIKVAVAASVFVFFAYFFFTYRTDNIAEDRSLNDKDKMGLLKGDSQTSSGYLIKSELLAAKNLSGANLKGTSDPYAIITCGNEKRFSSMVPGSRNPMWGEEFNFSVDKLPVQINITIYDWDIIWKSAVLGSVIVPVESEGQTGVVWHTLDSSSGQVCLHIKTTKRSANSSR* |
ORF Type | complete |
Blastp | BAG-associated GRAM protein 1 from Arabidopsis with 60% of identity |
---|---|
Blastx | BAG-associated GRAM protein 1 from Arabidopsis with 71.74% of identity |
Eggnog | GRAM domain-containing protein(ENOG410ZP01) |
Kegg | Link to kegg annotations (AT3G59660) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423975.1) |
Pfam | C2 domain (PF00168.29) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer