Transcript | Ll_transcript_293334 |
---|---|
CDS coordinates | 945-1442 (+) |
Peptide sequence | MNLIEKTHTADTRKPAFRWLGLKENQNSNLNKSRKRAFGTDITNMDFKRNKVDVFTDGEFSHNPKEQKELEHASGINQLDKSNLKHCTKQSSSSYEFGPFAPANVHKVGASENNNAKQVNDWESLATVHRPNYQNEGLKELFSHYMEAWKSWNSEVAGKRPDQNL* |
ORF Type | complete |
Blastp | E2F transcription factor-like E2FE from Arabidopsis with 43.27% of identity |
---|---|
Blastx | E2F transcription factor-like E2FE from Arabidopsis with 63.16% of identity |
Eggnog | E2F transcription factor(ENOG4111IGY) |
Kegg | Link to kegg annotations (AT3G48160) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463494.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer