Protein coding transcript 68218

• Transcript: Ll_transcript_293338
• CDS coordinates: 632-1453 (+)
• Peptide sequence: MTMQKCGMMRMTMKPYPIRVARMTGAFLLLMLPKCRRMVLPNCITQDNRREKSLALLTQNFVKLFICSNMELISLDDAARLLLGDAHNSSIMRTKVRRLYDIANVLSSMNLIEKTHTADTRKPAFRWLGLKENQNSNLNKSRKRAFGTDITNMDFKRNKVDVFTDGEFSHNPKEQKELEHASGINQLDKSNLKHCTKQSSSSYEFGPFAPANVHKVGASENNNAKQVNDWESLATVHRPNYQNEGLKELFSHYMEAWKSWNSEVAGKRPDQNL*
• ORF Type: complete

Annotations of Ll_transcript_293338

• Blastp: E2F transcription factor-like E2FE from Arabidopsis with 55.36% of identity
• Blastx: E2F transcription factor-like E2FE from Arabidopsis with 54.98% of identity
• Eggnog: E2F transcription factor(ENOG4111IGY)
• Kegg: Link to kegg annotations (AT3G48160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463494.1)
• Pfam: E2F/DP family winged-helix DNA-binding domain (PF02319.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;