Protein coding transcript 68244

• Transcript: Ll_transcript_292791
• CDS coordinates: 239-925 (+)
• Peptide sequence: MIGSAKMMDELYYFEDTFENKEAQGLSGMSSTPVKDRIMLWHNRLGHPNFQYLMHLFPDLFKNIDCSSLKCESCVLAKNQRAPYYSQPYHASRPFYLIHSDVWGPSKITTQFGKRWFVTFIDDHTRLCWIYLMHDKSEVPNIFKSFSQMVETQFDTKISILRSGNGLEYFNKNLNEFLKNKGIQHQSTCPNTPQQNGIAKRKNKHLLEVARAIMFESNLPKYFGGMLS*
• ORF Type: complete

Annotations of Ll_transcript_292791

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 42.62% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 30.74% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017415202.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;