Transcript | Ll_transcript_292785 |
---|---|
CDS coordinates | 5712-6392 (+) |
Peptide sequence | MAVIGKQVETFIREFFDQNPLSHVGLVTIKDGIAHSLTELGGSPESHIKALMGKLECSGDASLQDALELVLGSLNQIPSYGHREVLILYSALSTCDPGDLMETIQKCKKSKIRCSVICLAAEMFICKHLCQDTGGTYSVALDETHFKELILEHAPSPPAIAEYATANLIKMGFPQRAAEGSVAICTCHEEAKTGGGYTCPRCKVRVCELPTQCRICGLTLISSPHL* |
ORF Type | complete |
Blastp | General transcription factor IIH subunit 2 from Arabidopsis with 78.76% of identity |
---|---|
Blastx | General transcription factor IIH subunit 2 from Arabidopsis with 70.5% of identity |
Eggnog | Transcription factor(COG5151) |
Kegg | Link to kegg annotations (AT1G05055) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020998746.1) |
Pfam | Ssl1-like (PF04056.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer