Protein coding transcript 68251

• Transcript: Ll_transcript_292785
• CDS coordinates: 5712-6392 (+)
• Peptide sequence: MAVIGKQVETFIREFFDQNPLSHVGLVTIKDGIAHSLTELGGSPESHIKALMGKLECSGDASLQDALELVLGSLNQIPSYGHREVLILYSALSTCDPGDLMETIQKCKKSKIRCSVICLAAEMFICKHLCQDTGGTYSVALDETHFKELILEHAPSPPAIAEYATANLIKMGFPQRAAEGSVAICTCHEEAKTGGGYTCPRCKVRVCELPTQCRICGLTLISSPHL*
• ORF Type: complete

Annotations of Ll_transcript_292785

• Blastp: General transcription factor IIH subunit 2 from Arabidopsis with 78.76% of identity
• Blastx: General transcription factor IIH subunit 2 from Arabidopsis with 70.5% of identity
• Eggnog: Transcription factor(COG5151)
• Kegg: Link to kegg annotations (AT1G05055)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020998746.1)
• Pfam: Ssl1-like (PF04056.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;