Protein coding transcript 68273

• Transcript: Ll_transcript_292968
• CDS coordinates: 169-708 (+)
• Peptide sequence: MADKDEELEIPRDAKIVQSLLKSMGVEDYEPRVIHKFLELWYRYVVDVLTDAQVYSEHAGKSEIDCDDVKLSIQSKVNFSFSQPPPREVLLELAQNRNKIPLPKSIAGPGVNLPPDQDTLISPNYQLAIPNKRRAEPIEETEDEETAIPNPSQEYQMDMQIQQNPHQRVSFPLPKRQRD*
• ORF Type: complete

Annotations of Ll_transcript_292968

• Blastp: Transcription initiation factor TFIID subunit 9 from Arabidopsis with 84.85% of identity
• Blastx: Transcription initiation factor TFIID subunit 9 from Arabidopsis with 84.85% of identity
• Eggnog: RNA polymerase II, TATA box binding protein (TBP)-associated factor(COG5094)
• Kegg: Link to kegg annotations (AT1G54140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420115.1)
• Pfam: Transcription initiation factor IID, 31kD subunit (PF02291.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;