Transcript | Ll_transcript_292972 |
---|---|
CDS coordinates | 317-856 (+) |
Peptide sequence | MADKDEELEIPRDAKIVQSLLKSMGVEDYEPRVIHKFLELWYRYVVDVLTDAQVYSEHAGKSEIDCDDVKLSIQSKVNFSFSQPPPREVLLELAQNRNKIPLPKSIAGPGVNLPPDQDTLISPNYQLAIPNKRRAEPIEETEDEETAIPNPSQEYQMDMQIQQNPHQRVSFPLPKRQRD* |
ORF Type | complete |
Blastp | Transcription initiation factor TFIID subunit 9 from Arabidopsis with 84.85% of identity |
---|---|
Blastx | Transcription initiation factor TFIID subunit 9 from Arabidopsis with 84.85% of identity |
Eggnog | RNA polymerase II, TATA box binding protein (TBP)-associated factor(COG5094) |
Kegg | Link to kegg annotations (AT1G54140) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420115.1) |
Pfam | Transcription initiation factor IID, 31kD subunit (PF02291.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer