Transcript | Ll_transcript_292999 |
---|---|
CDS coordinates | 169-537 (+) |
Peptide sequence | MQIVHVEDICARIAIHTEMSIELSEQMRTALECIGVSKLYSHQAESIQASLNEKNVVVATMTSSGKSLCYNLPVLEVLCKSSSSCALYIFPTKYMELFLLSFFLLQLLQILVSILWNLQIYQQ |
ORF Type | 3prime_partial |
Blastp | Uncharacterized ATP-dependent helicase YprA from Bacillus with 37.63% of identity |
---|---|
Blastx | Uncharacterized ATP-dependent helicase YprA from Bacillus with 37.63% of identity |
Eggnog | DEAD DEAH box helicase(COG1205) |
Kegg | Link to kegg annotations (BSU22220) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415503.1) |
Pfam | DEAD/DEAH box helicase (PF00270.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer