Protein coding transcript 68297

• Transcript: Ll_transcript_293007
• CDS coordinates: 3-761 (+)
• Peptide sequence: SILWLNHEFSLFQELANLPTVELFQNDGSPSSRKLFILWNPVPRLKAILNKAQFAMGTDELADEISNCVRSSPIVDVSRLFAEMVKHGLRCIAFCKSRKLCELVLSYTREILHETAPHLMDSICAYRGGYIAEERRKIESAFFGGKICGVAATNALELGIDVGEIDVTLHLGFPGSIASLWQQAGRGGRRDRPSLAVYVAFGGPLDQYFMNHPKKLFESPIECCHIDSQNKQVLISYADSFLRLTILNFNKWK
• ORF Type: internal

Annotations of Ll_transcript_293007

• Blastp: Uncharacterized ATP-dependent helicase YprA from Bacillus with 37.44% of identity
• Blastx: Uncharacterized ATP-dependent helicase YprA from Bacillus with 37.44% of identity
• Eggnog: DEAD DEAH box helicase(COG1205)
• Kegg: Link to kegg annotations (BSU22220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415503.1)
• Pfam: Helicase conserved C-terminal domain (PF00271.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;