Transcript | Ll_transcript_458854 |
---|---|
CDS coordinates | 118-429 (+) |
Peptide sequence | MGEEKKGVEEVRYRGVRVRPWGKYGAEIRDPTKAKGRQWLGTFDTAKEAARAYDRAAIALRGALAVLNFPDEYYSHLPFVSSIFGSSDNNNGIGSSYSGNAECR |
ORF Type | 3prime_partial |
Blastp | Ethylene-responsive transcription factor ERF098 from Arabidopsis with 66.67% of identity |
---|---|
Blastx | Ethylene-responsive transcription factor ERF098 from Arabidopsis with 68.97% of identity |
Eggnog | ethylene-responsive transcription factor(ENOG410YQAX) |
Kegg | Link to kegg annotations (AT3G23230) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418309.1) |
Pfam | AP2 domain (PF00847.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer