Protein coding transcript 683

• Transcript: Ll_transcript_458854
• CDS coordinates: 118-429 (+)
• Peptide sequence: MGEEKKGVEEVRYRGVRVRPWGKYGAEIRDPTKAKGRQWLGTFDTAKEAARAYDRAAIALRGALAVLNFPDEYYSHLPFVSSIFGSSDNNNGIGSSYSGNAECR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_458854

• Blastp: Ethylene-responsive transcription factor ERF098 from Arabidopsis with 66.67% of identity
• Blastx: Ethylene-responsive transcription factor ERF098 from Arabidopsis with 68.97% of identity
• Eggnog: ethylene-responsive transcription factor(ENOG410YQAX)
• Kegg: Link to kegg annotations (AT3G23230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418309.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;