Protein coding transcript 68306

• Transcript: Ll_transcript_293016
• CDS coordinates: 169-588 (+)
• Peptide sequence: MQIVHVEDICARIAIHTEMSIELSEQMRTALECIGVSKLYSHQAESIQASLNEKNVVVATMTSSGKSLCYNLPVLEVLCKSSSSCALYIFPTKALAQDQLRSLLHMTKGFDVDFNIGIYDGDTSQSERTWLRENSRLVI*
• ORF Type: complete

Annotations of Ll_transcript_293016

• Blastp: Uncharacterized ATP-dependent helicase YprA from Bacillus with 38.69% of identity
• Blastx: Uncharacterized ATP-dependent helicase YprA from Bacillus with 38.69% of identity
• Eggnog: DEAD DEAH box helicase(COG1205)
• Kegg: Link to kegg annotations (BSU22220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415503.1)
• Pfam: DEAD/DEAH box helicase (PF00270.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;