Protein coding transcript 68310

• Transcript: Ll_transcript_292988
• CDS coordinates: 2-562 (+)
• Peptide sequence: FQILHEISKSILLYSITLFHLFLAWQDTKPLLVMDMVDHLKNGIGSNGQIVHVEDICARIAIHTEMSIELSEQMRTALECIGVSKLYSHQAESIQASLNEKNVVVATMTSSGKSLCYNLPVLEVLCKSSSSCALYIFPTKALAQDQLRSLLHMTKGFDVDFNIGIYDGDTSQSERTWLRENSRLVI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_292988

• Blastp: Uncharacterized ATP-dependent helicase YprA from Bacillus with 38.3% of identity
• Blastx: Uncharacterized ATP-dependent helicase YprA from Bacillus with 38.3% of identity
• Eggnog: DEAD DEAH box helicase(COG1205)
• Kegg: Link to kegg annotations (BSU22220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415502.1)
• Pfam: DEAD/DEAH box helicase (PF00270.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;