Protein coding transcript 68422

• Transcript: Ll_transcript_290678
• CDS coordinates: 228-725 (+)
• Peptide sequence: MSVWENMGDLANVAQLTGLDAVRLIGMIVKAASTARMHKKNCRQFAQHLKLIGNLLEQLKISELKRYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGWNIVYQFRKAQNEIDRYLRLVPLITLVDNARVRVCVNLKFAQLYLLSLVNFGVSMVNNLLLL*
• ORF Type: complete

Annotations of Ll_transcript_290678

• Blastp: Cell number regulator 13 from Zea with 82.35% of identity
• Blastx: Cell number regulator 13 from Zea with 82.35% of identity
• Eggnog: Mid1-complementing activity(ENOG410YER5)
• Kegg: Link to kegg annotations (100192784)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020209394.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;