Transcript | Ll_transcript_290653 |
---|---|
CDS coordinates | 429-926 (+) |
Peptide sequence | MSVWENMGDLANVAQLTGLDAVRLIGMIVKAASTARMHKKNCRQFAQHLKLIGNLLEQLKISELKRYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGWNIVYQFRKAQNEIDRYLRLVPLITLVDNARVRVCVNLKFAQLYLLSLVNFGVSMVNNLLLL* |
ORF Type | complete |
Blastp | Cell number regulator 13 from Zea with 82.35% of identity |
---|---|
Blastx | Cell number regulator 13 from Zea with 82.35% of identity |
Eggnog | Mid1-complementing activity(ENOG410YER5) |
Kegg | Link to kegg annotations (100192784) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020209394.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer