| Transcript | Ll_transcript_291151 |
|---|---|
| CDS coordinates | 437-847 (+) |
| Peptide sequence | MDSKAILDYALFQLTPTRTRFELVVFLGGKYEKIASGLFEPFVSHLKFVKDEISKGGYSIKLLPPNNGAFWFSKATFERFVRFVSTPAILERFASLENEILQIESSYQANASSMSIATADEGMVRVCSLNMLSIMC* |
| ORF Type | complete |
| Blastp | COP1-interacting protein 7 from Arabidopsis with 63.89% of identity |
|---|---|
| Blastx | COP1-interacting protein 7 from Arabidopsis with 63.89% of identity |
| Eggnog | NA(ENOG4111427) |
| Kegg | Link to kegg annotations (AT4G27430) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019425636.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer