| Transcript | Ll_transcript_458848 |
|---|---|
| CDS coordinates | 3-413 (+) |
| Peptide sequence | GLFSGKYKTTDVPESGRFSDAEGTRGSAYRKRYFKDATFEALRVIEPVVEKHNLTLLETAFRWVLHHSDLNIKDGGNDGIVIGVSSNAQLEGNLKDVEKGPLPKEVVDALDEAWLIAKPTSVNYWHLDLKYTYDTRE |
| ORF Type | internal |
| Blastp | - |
|---|---|
| Blastx | Aflatoxin B1 aldehyde reductase member 3 from Homo with 35.61% of identity |
| Eggnog | Aldo keto reductase(COG0667) |
| Kegg | Link to kegg annotations (22977) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_017415678.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer