Protein coding transcript 68500

• Transcript: Ll_transcript_291154
• CDS coordinates: 437-937 (+)
• Peptide sequence: MDSKAILDYALFQLTPTRTRFELVVFLGGKYEKIASGLFEPFVSHLKFVKDEISKGGYSIKLLPPNNGAFWFSKATFERFVRFVSTPAILERFASLENEILQIESSYQANASSMSIATADEGSMPQTNGLLRRLSDSTKAFYLLRSISKLNGVLEDVDNKEEENSK*
• ORF Type: complete

Annotations of Ll_transcript_291154

• Blastp: COP1-interacting protein 7 from Arabidopsis with 63.89% of identity
• Blastx: COP1-interacting protein 7 from Arabidopsis with 63.89% of identity
• Eggnog: NA(ENOG4111427)
• Kegg: Link to kegg annotations (AT4G27430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425636.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;