Transcript | Ll_transcript_292124 |
---|---|
CDS coordinates | 194-550 (+) |
Peptide sequence | MSLRLFTAPPLTPYTTHTQTHTHFQSSKLSFHHNSLNSQLLISETNRARPGLPISHDLTSIDVDAVTETELKENGFRSTRRTKLVCTIGPATCGFEEVEALAVGGMNVVKNMCHRTKE* |
ORF Type | complete |
Blastp | Pyruvate kinase isozyme A, chloroplastic from Ricinus with 71.08% of identity |
---|---|
Blastx | Pyruvate kinase isozyme A, chloroplastic from Ricinus with 77.54% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (8280200) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441131.1) |
Pfam | Pyruvate kinase, barrel domain (PF00224.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer