Protein coding transcript 68520

• Transcript: Ll_transcript_292128
• CDS coordinates: 139-495 (+)
• Peptide sequence: MSLRLFTAPPLTPYTTHTQTHTHFQSSKLSFHHNSLNSQLLISETNRARPGLPISHDLTSIDVDAVTETELKENGFRSTRRTKLVCTIGPATCGFEEVEALAVGGMNVVKNMCHRTKE*
• ORF Type: complete

Annotations of Ll_transcript_292128

• Blastp: Pyruvate kinase isozyme A, chloroplastic from Ricinus with 71.08% of identity
• Blastx: Pyruvate kinase isozyme A, chloroplastic from Ricinus with 77.54% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (8280200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441131.1)
• Pfam: Pyruvate kinase, barrel domain (PF00224.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;