Transcript | Ll_transcript_292023 |
---|---|
CDS coordinates | 163-963 (+) |
Peptide sequence | MASTLPNASFTLNNASFSDGKTYVGVPLMPTNLKFCSSSKSRQSSHLFAVKASNSQNGPGFLKKLGLTDAQCEAAVVAGNVPHAPPVPPKPAAPIGTPVVPSLPLSRRPRRNRRSPVLREAFQETSLSPANFVYPLFIHEGEQDTPIGAMPGCYRLGWRHGLVEEVAKARDVGVNSVVLFPKIPDALKTPTGVEAYNEDGLAPRTIRLLKDKYPDLVIYTDVALDPYSSDGHDGIVREDGVIMNDETVHQLCKQAVAQVIGLLSYM* |
ORF Type | complete |
Blastp | Delta-aminolevulinic acid dehydratase 1, chloroplastic from Arabidopsis with 71.04% of identity |
---|---|
Blastx | Delta-aminolevulinic acid dehydratase, chloroplastic from Pisum with 94.93% of identity |
Eggnog | delta-aminolevulinic acid dehydratase(COG0113) |
Kegg | Link to kegg annotations (AT1G69740) |
CantataDB | Link to cantataDB annotations (CNT0001653) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415140.1) |
Pfam | Delta-aminolevulinic acid dehydratase (PF00490.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer