Protein coding transcript 68611

• Transcript: Ll_transcript_292024
• CDS coordinates: 163-1197 (+)
• Peptide sequence: MASTLPNASFTLNNASFSDGKTYVGVPLMPTNLKFCSSSKSRQSSHLFAVKASNSQNGPGFLKKLGLTDAQCEAAVVAGNVPHAPPVPPKPAAPIGTPVVPSLPLSRRPRRNRRSPVLREAFQETSLSPANFVYPLFIHEGEQDTPIGAMPGCYRLGWRHGLVEEVAKARDVGVNSVVLFPKIPDALKTPTGVEAYNEDGLAPRTIRLLKDKYPDLVIYTDVALDPYSSDGHDGIVREDGVIMNDETVHQLCKQAVAQARAGADVVSPSDMMDGRVGAIRAALDAEGFQHVSIMSYTAKYASSFYGPFREALDSNPRFGDKKTYQMNPANYREALTELREDESEG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_292024

• Blastp: Delta-aminolevulinic acid dehydratase 1, chloroplastic from Arabidopsis with 76.88% of identity
• Blastx: Delta-aminolevulinic acid dehydratase, chloroplastic from Pisum with 95.56% of identity
• Eggnog: delta-aminolevulinic acid dehydratase(COG0113)
• Kegg: Link to kegg annotations (AT1G69740)
• CantataDB: Link to cantataDB annotations (CNT0001653)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415140.1)
• Pfam: Delta-aminolevulinic acid dehydratase (PF00490.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;