Protein coding transcript 68664

• Transcript: Ll_transcript_290761
• CDS coordinates: 255-581 (+)
• Peptide sequence: MRKHGWQLPYHPLQVVAVSVFLALGFAFFVFFAPFVGNQMHQYIVMGLYTPLITCVFGLYIWCAATDPADSGVFKSKKYLKMAYTESADGLKDSKLAALVQVRNPLIS*
• ORF Type: complete

Annotations of Ll_transcript_290761

• Blastp: Probable protein S-acyltransferase 22 from Arabidopsis with 85.37% of identity
• Blastx: Probable protein S-acyltransferase 22 from Arabidopsis with 74.3% of identity
• Eggnog: Zinc finger, DHHC-type containing(COG5273)
• Kegg: Link to kegg annotations (AT1G69420)
• CantataDB: Link to cantataDB annotations (CNT0002609)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421859.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;