| Transcript | Ll_transcript_467588 |
|---|---|
| CDS coordinates | 3389-3793 (+) |
| Peptide sequence | MTQRSGVQILEKIVDIDSRMVGVCYPTLLIFGCFMQSGCCKPSNDCGFTYQSPTRWTKTGNLSHTNPDCDSWSNDPNIMCFNCQSCKAALLQNTKTDWRKVSLVNAIILILLSIVYSIGCCAFRNIKKDNWKGY* |
| ORF Type | complete |
| Blastp | Tetraspanin-7 from Arabidopsis with 57.73% of identity |
|---|---|
| Blastx | Tetraspanin-8 from Arabidopsis with 59.76% of identity |
| Eggnog | Tetraspanin family(ENOG4110562) |
| Kegg | Link to kegg annotations (AT4G28050) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019453824.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer