Transcript | Ll_transcript_467570 |
---|---|
CDS coordinates | 3-371 (+) |
Peptide sequence | SLCLWYVALYCYYFLVLFWIIMQSGCCKPSTDCGFTYQSPTSWTKTGNATYTNPDCDSWNNDPNLLCYNCQSCKAGLLQNIKSDWKKVAIVNIIFLVFLIIVYSIGCCAFRNNRTNNYYKGY* |
ORF Type | 5prime_partial |
Blastp | - |
---|---|
Blastx | Tetraspanin-7 from Arabidopsis with 67.01% of identity |
Eggnog | Tetraspanin family(ENOG4110562) |
Kegg | Link to kegg annotations (AT4G28050) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453810.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer