Protein coding transcript 68699

• Transcript: Ll_transcript_467577
• CDS coordinates: 2764-3528 (+)
• Peptide sequence: MVRCSNSLIGILNFLTFLLSIPILLTGIWLSKQAHTECDRWLEIPIIAFGVFLLVISLAGLIGACCHVRWLLWLYLVVMFMLILILSAFSIFIFVVTIKGDGEELSGKGYKEYRLGNYSITLQNRVNNPAAWNRMKSCLQSSQICSQFHKQYVNDNVDQFYNEKLSALQSGCCKPSNDCGFTYQSPTRWTKTGNLSHTNPDCDSWSNDPNIMCFNCQSCKAALLQNTKTDWRKVSLVNAIILILLSIVYSIGCCA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_467577

• Blastp: Tetraspanin-8 from Arabidopsis with 59.61% of identity
• Blastx: Tetraspanin-8 from Arabidopsis with 59.61% of identity
• Eggnog: senescence-associated protein(ENOG410XRN9)
• Kegg: Link to kegg annotations (AT2G23810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453824.1)
• Pfam: Tetraspanin family (PF00335.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;