Protein coding transcript 687

• Transcript: Ll_transcript_458830
• CDS coordinates: 10-828 (+)
• Peptide sequence: MAMTTSNTSLTQLFLPTFITFFLILLNKVNSSSNHISFTINKFISNETDLIFQGDASVSSTGTLQLTKIENNQPTQNSVGRVLYSKPIHIWDSKKGKVASFTTSFSFIVSSSDTNQPADGLAFFLAPSDTQIPPNSIGNGGFLGIFNDQTLNTSNQIVAVEFDTYTGNDWDPSFQHIGIDVNTIASIQTSAWNWRNGEVANVIINYVASNKTLTATLTYPSDKTSISVTASVDLKTILPEFARVGFSGATGALVETNNILRWSFSSTFKSKN*
• ORF Type: complete

Annotations of Ll_transcript_458830

• Blastp: Lectin-related protein from Cladrastis with 59.92% of identity
• Blastx: Lectin-related protein from Cladrastis with 59.04% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465127.1)
• Pfam: Legume lectin domain (PF00139.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;