Protein coding transcript 68736

• Transcript: Ll_transcript_466139
• CDS coordinates: 759-1085 (+)
• Peptide sequence: MSAVCLLDETWSTLMINFLFNEVSVNFHMFCSIMVNWVLCNDYGSLVVTKYSHSVVSGNFDFIQHSFELDPSPIPCAIALNSASALLLATTDCFSLLQVTKFPHTNVQ*
• ORF Type: complete

Annotations of Ll_transcript_466139

• Blastp: Uncharacterized mitochondrial protein AtMg00810 from Arabidopsis with 39.89% of identity
• Blastx: Uncharacterized mitochondrial protein AtMg00810 from Arabidopsis with 39.82% of identity
• Eggnog: Retrotransposon protein(COG2801)
• Kegg: Link to kegg annotations (ArthMp070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020218570.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF07727.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;